PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS69272.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 163aa    MW: 18332.7 Da    PI: 10.2482
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS69272.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.2e-192368148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T+eE+e +v+++k lG++ W+ Ia++++ gRt++++k++w+++l
       EPS69272.1 23 RGNFTAEEEETIVKLHKSLGNR-WAIIASHLP-GRTDNEIKNYWNSHL 68
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.147417IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.3E-11429IPR009057Homeodomain-like
SuperFamilySSF466891.17E-21475IPR009057Homeodomain-like
PROSITE profilePS5129426.7581872IPR017930Myb domain
SMARTSM007178.5E-182270IPR001005SANT/Myb domain
PfamPF002495.5E-172368IPR001005SANT/Myb domain
CDDcd001672.24E-132568No hitNo description
Gene3DG3DSA:1.10.10.604.4E-233068IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
GLLRCGKSCR LRWMNYLRED VKRGNFTAEE EETIVKLHKS LGNRWAIIAS HLPGRTDNEI  60
KNYWNSHLSR EIYRFRSTVA DPPVITAADV IRMSSSPAPK RRAGRVSRAL AKKYNNKPAA  120
AATKKNGPSS SSSSPNPTTA MDDDKEEEDD SFFLLPPPPP HRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2147240108B-MYB
1gv2_A6e-2147237105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-2147237105C-Myb DNA-Binding Domain
1msf_C6e-2147237105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071652.15e-62PREDICTED: transcription factor MYB12
SwissprotO222647e-44MYB12_ARATH; Transcription factor MYB12
TrEMBLS8E9U51e-118S8E9U5_9LAMI; Uncharacterized protein (Fragment)
STRINGBra037419.1-P2e-44(Brassica rapa)
STRINGGSMUA_Achr8P10470_0013e-44(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1966523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.15e-44myb domain protein 111
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]